Recombinant Swine TNF alpha protein(N-His)(active)

Abbreviation: TNF alpha

Target Synonym: TNFSF2;Cachectin;Differentiation-inducing factor (DIF);Necrosin;Cytotoxin;TNS_x0002_F1A

Target Species: Porcine

Expression Host: E.coli

Fusion Tag: N-His

UNIProt ID: P23563

Background: Tumor necrosis factor alpha (TNFα) is the prototypic ligand of the TNF superfamily. TNFα forms a homotrimer and functions by activating two types of receptors TNF-R1 (TNF receptor type 1,p55R) and TNF-R2 (TNF receptor type 2,p75R). TNFα is a pleiotropic cytokine that is capable to promote inflammation, to induce apoptotic cell death, and to inhibit tumorigenesis and viral replication. TNFα is a potent lymphoid factor that exerts cytotoxic effects on a wide range of tumor cells and certain other target cells.

Activity: Measure by its ability to induce cytotoxicity in PK15 cells in the presence of the actinomycin D. The ED50 for this effect is < 15 pg/mL.

Sequence: MSTESMIRDVELAEEALAKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFEVIGPQKEEFPAGPLSINPLAQGLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Endotoxin: Please contact us for more information.

• Artikelnummer: ELSPKSS000010-5
• Hersteller: Elabscience Biotechnology
• Hersteller Artikelnummer: ELA-PKSS000010-5
• Verpackungseinheit: 5 µg
• Mengeneinheit: STK
• Methode: Cell Culture