RFESD Antibody - middle region : FITC

RFESD Antibody - middle region : FITC
Artikelnummer
AVIARP55631_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RFESD

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: VVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rieske domain-containing protein

Protein Size: 157

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55631_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55631_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 317671
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×