RGD1307041 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: MLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein RGD1307041 Ensembl ENSRNOP00000049378

Protein Size: 399

Purification: Affinity Purified

• Artikelnummer: AVIARP57230_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57230_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 361182
• Wirt: Rabbit