RGL3 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: RGL3 is a guanine nucleotide exchange factor (GEF) for Ral-A. RGL3 is a potential effector of GTPase HRas and Ras-related protein M-Ras. RGL3 negatively regulates Elk-1-dependent gene induction downstream of HRas and MEKK1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RGL3

Molecular Weight: 78kDa

Peptide Sequence: Synthetic peptide located within the following region: RNFSSLRAILSALQSNPIYRLKRSWGAVSREPLSTFRKLSQIFSDENNHL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ral guanine nucleotide dissociation stimulator-like 3

Protein Size: 710

Purification: Affinity Purified

• Artikelnummer: AVIARP56251_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56251_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57139
• Wirt: Rabbit