RGS22 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: RGS22 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RGS22

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 147kDa

Peptide Sequence: Synthetic peptide located within the following region: QTVSTFSLPCCVPYNKLKSPAISSVSENFIFDDGVHPRTKKDPSKTNKLI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Regulator of G-protein signaling 22

Protein Size: 1264

Purification: Affinity Purified

• Artikelnummer: AVIARP55320_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55320_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 26166
• Wirt: Rabbit