RHOF Antibody - middle region : FITC

RHOF Antibody - middle region : FITC
Artikelnummer
AVIARP57310_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RHOF is a plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. RHOF causes the formation of thin, actin-rich surface projections called filopodia. RHOF functions cooperatively with CDC42 and Rac

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RHOF

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: DNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho-related GTP-binding protein RhoF

Protein Size: 211

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57310_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57310_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54509
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×