RIC8B Antibody - middle region : FITC

RIC8B Antibody - middle region : FITC
Artikelnummer
AVIARP57132_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RIC8B

Key Reference: Klattenhoff,C., (2003) J. Cell. Physiol. 195 (2), 151-157

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: KETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Synembryn-B

Protein Size: 520

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57132_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57132_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55188
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×