English
RIPK5 Antibody - middle region : FITC
RIPK5 Antibody - middle region : FITC
Artikelnummer
AVIARP55938_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. Multiple alternatively spliced transcript variants have been found, but the biological validity of some variants has not been determined.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RIPK5
Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Molecular Weight: 100kDa
Peptide Sequence: Synthetic peptide located within the following region: EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Dual serine/threonine and tyrosine protein kinase
Protein Size: 884
Purification: Affinity Purified
Description of Target: RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. Multiple alternatively spliced transcript variants have been found, but the biological validity of some variants has not been determined.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RIPK5
Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Molecular Weight: 100kDa
Peptide Sequence: Synthetic peptide located within the following region: EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Dual serine/threonine and tyrosine protein kinase
Protein Size: 884
Purification: Affinity Purified
| Artikelnummer | AVIARP55938_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55938_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 25778 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
