RIPK5 Antibody - middle region : HRP

RIPK5 Antibody - middle region : HRP
Artikelnummer
AVIARP55938_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. Multiple alternatively spliced transcript variants have been found, but the biological validity of some variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RIPK5

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Dual serine/threonine and tyrosine protein kinase

Protein Size: 884

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55938_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55938_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25778
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×