RLN1 Antibody - middle region : FITC

RLN1 Antibody - middle region : FITC
Artikelnummer
AVIARP56721_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Relaxins are known endocrine and autocrine/paracrine hormones, belonging to the insulin gene superfamily. In the human there are three non-allelic relaxin genes, RLN1, RLN2 and RLN3. RLN1 and RLN2 share high sequence homology. This encoded protein is synthesized as a single-chain polypeptide but the active form consists of an A chain and a B chain linked by disulfide bonds; however, their exact cleavage sites have not been described. Relaxin is produced by the ovary, and targets the mammalian reproductive system to ripen the cervix, elongate the pubic symphysis and inhibit uterine contraction. It may have additional roles in enhancing sperm motility, regulating blood pressure, controlling heart rate and releasing oxytocin and vasopressin. This gene has multiple polyadenylation sites. There are multiple alternatively spliced transcript variants described for this gene but their full length nature is not known yet.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RLN1

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: EIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prorelaxin H1

Protein Size: 185

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56721_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56721_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6013
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×