RMND1 Antibody - middle region : HRP

RMND1 Antibody - middle region : HRP
Artikelnummer
AVIARP57061_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RMND1

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: LEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRGEIKLNSELDLDDAIL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Required for meiotic nuclear division protein 1 homolog

Protein Size: 449

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57061_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57061_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55005
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×