RORC Antibody - N-terminal region : Biotin

RORC Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58193_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RORC

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: RAR-related orphan receptor C EMBL AAI10572.1

Protein Size: 518

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58193_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58193_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6097
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×