RP11-298P3.3 Antibody - middle region : Biotin

RP11-298P3.3 Antibody - middle region : Biotin
Artikelnummer
AVIARP55407_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RP11-298P3.3

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: TSCSLGVTSDFHFLNERFDRKLKRWEEPKELPAEDSQDLTSTDYRSLELP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NEDD4-binding protein 2-like 2

Protein Size: 752

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55407_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55407_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10443
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×