RP2 Antibody - middle region : HRP

RP2 Antibody - middle region : HRP
Artikelnummer
AVIARP56724_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefo

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RP2

Key Reference: Grimwood,J., (2004) Nature 428 (6982), 529-535

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein XRP2

Protein Size: 350

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56724_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56724_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 6102
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×