RPA4 Antibody - C-terminal region : FITC

RPA4 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54942_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. RPA4 is the 32-kDa subunit of the RPA, which associates with the 70- and 13-kDa subunits to form a trimeric RPA complex.Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. This gene encodes the 32-kDa subunit of the RPA, which associates with the 70- and 13-kDa subunits to form a trimeric RPA complex. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1448 BC069824.1 1-1448

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RPA4

Key Reference: Wu,X., Biochem. J. 391 (PT 3), 473-480 (2005)

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: HQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Replication protein A 30 kDa subunit

Protein Size: 261

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54942_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54942_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29935
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×