RPE Antibody - middle region : Biotin

RPE Antibody - middle region : Biotin
Artikelnummer
AVIARP56725_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPE

Key Reference: Veltel,S., (2008) Nat. Struct. Mol. Biol. 15 (4), 373-380

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ribulose-phosphate 3-epimerase

Protein Size: 228

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56725_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56725_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 6120
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×