Rpl17 Antibody - N-terminal region : HRP

Rpl17 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56129_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: SLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 60S ribosomal protein L17

Protein Size: 184

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56129_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56129_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 319195
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×