RPL37A Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPL37A

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 60S ribosomal protein L37a

Protein Size: 92

Purification: Affinity Purified

• Artikelnummer: AVIARP56137_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56137_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6168
• Wirt: Rabbit