Rpl5 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Rpl5 is required for rRNA maturation and formation of the 60S ribosomal subunits. This protein binds 5S RNA.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: RTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 60S ribosomal protein L5

Protein Size: 297

Purification: Affinity Purified

• Artikelnummer: AVIARP56126_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56126_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 19983
• Wirt: Rabbit