RPS13 Antibody - N-terminal region : Biotin

RPS13 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56179_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPS13

Key Reference: Malygin,A.A., (2007) Nucleic Acids Res. 35 (19), 6414-6423

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 40S ribosomal protein S13

Protein Size: 151

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56179_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56179_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6207
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×