RPS13 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPS13

Key Reference: Malygin,A.A., (2007) Nucleic Acids Res. 35 (19), 6414-6423

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 40S ribosomal protein S13

Protein Size: 151

Purification: Affinity Purified

• Artikelnummer: AVIARP56179_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56179_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6207
• Wirt: Rabbit