Rps8 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rps8

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: KKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 40S ribosomal protein S8

Protein Size: 208

Purification: Affinity Purified

• Artikelnummer: AVIARP56156_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56156_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 20116
• Wirt: Rabbit