RRAD Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RRAD may play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca2+ currents. RRAD regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking to the cell membrane. RRAD inhibits cardiac hy

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RRAD

Key Reference: Chang,L., (2007) Circulation 116 (25), 2976-2983

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: YDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTP-binding protein RAD

Protein Size: 308

Purification: Affinity Purified

• Artikelnummer: AVIARP56567_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56567_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6236
• Wirt: Rabbit