RRAD Antibody - middle region : HRP

RRAD Antibody - middle region : HRP
Artikelnummer
AVIARP56566_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RRAD may play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca2+ currents. RRAD regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking to the cell membrane. RRAD inhibits cardiac hy

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RRAD

Key Reference: Chang,L., (2007) Circulation 116 (25), 2976-2983

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: LARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: GTP-binding protein RAD

Protein Size: 308

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56566_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56566_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6236
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×