RRAGC Antibody - N-terminal region : HRP

RRAGC Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57617_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the GTR/RAG GTP-binding protein family. The encoded protein is a monomeric guanine nucleotide-binding protein which forms a heterodimer with RRAGA and RRAGB and is primarily localized to the cytoplasm. The encoded protein promotes intracellular localization of the mTOR complex. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RRAGC

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related GTP-binding protein C

Protein Size: 399

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57617_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57617_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64121
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×