RRAGD Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: RRAGD is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RRAGD

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related GTP-binding protein D

Protein Size: 400

Purification: Affinity Purified

• Artikelnummer: AVIARP57542_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57542_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 58528
• Wirt: Rabbit