RSPH14 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RTDR1

Key Reference: Gerhard,D.S., (2005) Science 307 (5715), 1621-1625

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: radial spoke head 14 homolog

Protein Size: 348

Purification: Affinity Purified

• Artikelnummer: AVIARP55056_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55056_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 27156
• Wirt: Rabbit