RSPH14 Antibody - N-terminal region : Biotin

RSPH14 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55055_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RTDR1

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: radial spoke head 14 homolog

Protein Size: 348

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55055_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55055_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27156
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×