English
RTKN Antibody - N-terminal region : FITC
RTKN Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56210_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: RTKN mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. RTKN may play a novel role in the organization of septin structures.This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RTKN
Key Reference: Sudo,K., (2007) Hum. Mutat. 28 (10), 1005-1013
Molecular Weight: 63kDa
Peptide Sequence: Synthetic peptide located within the following region: DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Rhotekin
Protein Size: 563
Purification: Affinity Purified
Description of Target: RTKN mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. RTKN may play a novel role in the organization of septin structures.This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RTKN
Key Reference: Sudo,K., (2007) Hum. Mutat. 28 (10), 1005-1013
Molecular Weight: 63kDa
Peptide Sequence: Synthetic peptide located within the following region: DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Rhotekin
Protein Size: 563
Purification: Affinity Purified
| Artikelnummer | AVIARP56210_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56210_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 6242 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
