S100A6 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human S10A6

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: ELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: protein S100-A6

Protein Size: 90

Purification: Affinity Purified

• Artikelnummer: AVIARP56747_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56747_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6277
• Wirt: Rabbit