SAMHD1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SAMHD1 contains 1 HD domain and 1 SAM (sterile alpha motif) domain. SAMHD1 may play a role in mediating proinflammatory responses to TNF-alpha signaling.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SAMHD1

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: KGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: SAM domain and HD domain-containing protein 1

Protein Size: 626

Purification: Affinity Purified

• Artikelnummer: AVIARP55262_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55262_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 25939
• Wirt: Rabbit