SCO1 Antibody - middle region : Biotin

SCO1 Antibody - middle region : Biotin
Artikelnummer
AVIARP56592_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane. In yeast, 2 related COX assembly genes, SCO1 and SCO2 (synthesis of cytoch

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SCO1

Key Reference: Banci,L., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (19), 6803-6808

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein SCO1 homolog, mitochondrial

Protein Size: 301

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56592_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56592_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6341
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×