SCO1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane. In yeast, 2 related COX assembly genes, SCO1 and SCO2 (synthesis of cytoch

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SCO1

Key Reference: Banci,L., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (19), 6803-6808

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein SCO1 homolog, mitochondrial

Protein Size: 301

Purification: Affinity Purified

• Artikelnummer: AVIARP56592_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56592_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6341
• Wirt: Rabbit