SCP2 Antibody - middle region : FITC

SCP2 Antibody - middle region : FITC
Artikelnummer
AVIARP56538_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SCP2

Key Reference: Stanley,W.A., (2007) Arch. Biochem. Biophys. 461 (1), 50-58

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Non-specific lipid-transfer protein

Protein Size: 322

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56538_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56538_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6342
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×