Sema3f Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Semaphorin-3F

Protein Size: 754

Purification: Affinity Purified

• Artikelnummer: AVIARP56569_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56569_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Immunoprecipitation, Western Blotting, Immunohistochemistry
• Human Gene ID: 20350
• Wirt: Rabbit