English
SENP1 Antibody - middle region : Biotin
SENP1 Antibody - middle region : Biotin
Artikelnummer
AVIARP55082_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: The covalent modification of proteins by the small ubiquitin-like protein SUMO is implicated in the regulation of nucleocytoplasmic transport, genomic stability, gene transcription, and other processes. Sumoylation is catalyzed on target lysine residues by a multienzyme process and is reversed by desumoylating enzymes such as SENP1.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SENP1
Key Reference: Ohbayashi,N., (2008) Biochem. Biophys. Res. Commun. 371 (4), 823-828
Molecular Weight: 73kDa
Peptide Sequence: Synthetic peptide located within the following region: PQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Sentrin-specific protease 1
Protein Size: 643
Purification: Affinity Purified
Description of Target: The covalent modification of proteins by the small ubiquitin-like protein SUMO is implicated in the regulation of nucleocytoplasmic transport, genomic stability, gene transcription, and other processes. Sumoylation is catalyzed on target lysine residues by a multienzyme process and is reversed by desumoylating enzymes such as SENP1.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SENP1
Key Reference: Ohbayashi,N., (2008) Biochem. Biophys. Res. Commun. 371 (4), 823-828
Molecular Weight: 73kDa
Peptide Sequence: Synthetic peptide located within the following region: PQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Sentrin-specific protease 1
Protein Size: 643
Purification: Affinity Purified
| Artikelnummer | AVIARP55082_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55082_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 29843 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
