SENP2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SUMO1 (UBL1; MIM 601912) is a small ubiquitin-like protein that can be covalently conjugated to other proteins. SENP2 is one of a group of enzymes that process newly synthesized SUMO1 into the conjugatable form and catalyze the deconjugation of SUMO1-containing species.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SENP2

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: RICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sentrin-specific protease 2

Protein Size: 589

Purification: Affinity Purified

• Artikelnummer: AVIARP57548_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57548_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 59343
• Wirt: Rabbit