SEPT11 Antibody - N-terminal region : Biotin

SEPT11 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57173_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: SEPT11 belongs to the conserved septin family of filament-forming cytoskeletal GTPases that are involved in a variety of cellular functions including cytokinesis and vesicle trafficking.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT11(septin 11)

Key Reference: Xin,X., (2007) J. Histochem. Cytochem. 55 (11), 1089-1094

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Septin-11

Protein Size: 429

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57173_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57173_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 55752
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×