SEPT2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SEPT2

Key Reference: Spiliotis,E.T., (2008) J. Cell Biol. 180 (2), 295-303

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: LQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Septin-2

Protein Size: 361

Purification: Affinity Purified

• Artikelnummer: AVIARP56661_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56661_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4735
• Wirt: Rabbit