SERINC2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SERINC2

Key Reference: Player,A., (2003) Int. J. Cancer 107 (2), 238-243

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine incorporator 2

Protein Size: 455

Purification: Affinity Purified

• Artikelnummer: AVIARP55789_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55789_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 347735
• Wirt: Rabbit