English
SERINC2 Antibody - N-terminal region : HRP
SERINC2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55789_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: The specific function of this protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SERINC2
Key Reference: Player,A., (2003) Int. J. Cancer 107 (2), 238-243
Molecular Weight: 51kDa
Peptide Sequence: Synthetic peptide located within the following region: VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Serine incorporator 2
Protein Size: 455
Purification: Affinity Purified
Description of Target: The specific function of this protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SERINC2
Key Reference: Player,A., (2003) Int. J. Cancer 107 (2), 238-243
Molecular Weight: 51kDa
Peptide Sequence: Synthetic peptide located within the following region: VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Serine incorporator 2
Protein Size: 455
Purification: Affinity Purified
| Artikelnummer | AVIARP55789_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55789_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 347735 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
