SERPINB2 Antibody - middle region : HRP

SERPINB2 Antibody - middle region : HRP
Artikelnummer
AVIARP56375_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SERPINB2 inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINB2

Key Reference: Croucher,D.R., (2007) Biochem. J. 408 (2), 203-210

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Plasminogen activator inhibitor 2

Protein Size: 415

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56375_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56375_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5055
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×