SERPINF2 Antibody - N-terminal region : Biotin

SERPINF2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP59189_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of the serpin family of serine protease inhibitors. The protein is a major inhibitor of plasmin, which degrades fibrin and various other proteins. Consequently, the proper function of this gene has a major role in regulating the blood clotting pathway. Mutations in this gene result in alpha-2-plasmin inhibitor deficiency, which is characterized by severe hemorrhagic diathesis. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SERPINF2

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: CSRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Alpha-2-antiplasmin

Protein Size: 491

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59189_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59189_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 5345
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×