English
SERPINF2 Antibody - N-terminal region : Biotin
SERPINF2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP59189_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: This gene encodes a member of the serpin family of serine protease inhibitors. The protein is a major inhibitor of plasmin, which degrades fibrin and various other proteins. Consequently, the proper function of this gene has a major role in regulating the blood clotting pathway. Mutations in this gene result in alpha-2-plasmin inhibitor deficiency, which is characterized by severe hemorrhagic diathesis. Multiple transcript variants encoding different isoforms have been found for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SERPINF2
Molecular Weight: 54kDa
Peptide Sequence: Synthetic peptide located within the following region: CSRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSH
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Alpha-2-antiplasmin
Protein Size: 491
Purification: Affinity Purified
Description of Target: This gene encodes a member of the serpin family of serine protease inhibitors. The protein is a major inhibitor of plasmin, which degrades fibrin and various other proteins. Consequently, the proper function of this gene has a major role in regulating the blood clotting pathway. Mutations in this gene result in alpha-2-plasmin inhibitor deficiency, which is characterized by severe hemorrhagic diathesis. Multiple transcript variants encoding different isoforms have been found for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SERPINF2
Molecular Weight: 54kDa
Peptide Sequence: Synthetic peptide located within the following region: CSRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSH
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Alpha-2-antiplasmin
Protein Size: 491
Purification: Affinity Purified
| Artikelnummer | AVIARP59189_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP59189_P050-Biotin |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting, Immunohistochemistry |
| Human Gene ID | 5345 |
| Wirt | Rabbit |
| Konjugat | Conjugated, Biotin |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
