SETD4 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SETD4

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: NAVLQKVSHMKDEKEALINQLTLVESLWTEELKILRASAETLHSLQTAFT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SET domain-containing protein 4

Protein Size: 440

Purification: Affinity purified

• Artikelnummer: AVIARP58045_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58045_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54093
• Wirt: Rabbit