SGK1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell sur

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SGK1

Key Reference: Pew,T., (2008) Endocrinology 149 (5), 2637-2645

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase Sgk1

Protein Size: 431

Purification: Affinity Purified

• Artikelnummer: AVIARP56652_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56652_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 6446
• Wirt: Rabbit