SH3BP4 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of a specific protein receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SH3BP4

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: PSSYVQPLNYRNSTLSDSGMIDNLPDSPDEVAKELELLGGWTDDKKVPGR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SH3 domain-binding protein 4

Protein Size: 552

Purification: Affinity Purified

• Artikelnummer: AVIARP55076_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55076_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23677
• Wirt: Rabbit