SH3GL1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: SH3GL1 is implicated in endocytosis. It may recruit other proteins to membranes with high curvature.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SH3GL1

Key Reference: Ralser,M., (2005) Hum. Mol. Genet. 14 (19), 2893-2909

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Endophilin-A2

Protein Size: 368

Purification: Affinity Purified

• Artikelnummer: AVIARP56547_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56547_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6455
• Wirt: Rabbit