Shq1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Shq1 is required for the quantitative accumulation of H/ACA ribonucleoproteins (RNPs), including telomerase, probably through the stabilization of DKC1, from the time of its synthesis until its association with NOP10, NHP2, and NAF1 at the nascent H/ACA RNA.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Shq1

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: PYFLRLTLPGRIVENGSEQGTYDADKGIFTIRLPKETPGQHFEGLNMLTA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein SHQ1 homolog

Protein Size: 458

Purification: Affinity Purified

• Artikelnummer: AVIARP57120_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57120_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 72171
• Wirt: Rabbit