SMAP1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: stromal membrane-associated protein 1

Protein Size: 467

Purification: Affinity Purified

• Artikelnummer: AVIARP56281_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56281_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 684800
• Wirt: Rabbit