English
SMARCD1 Antibody - middle region : HRP
SMARCD1 Antibody - middle region : HRP
Artikelnummer
AVIARP58324_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: SMARCD1 is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. It is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein.The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Two transcript variants encoding different isoforms have been found for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SMARCD1
Key Reference: Assmann,E.M., (2006) J. Biol. Chem. 281 (15), 9869-9881
Molecular Weight: 58kDa
Peptide Sequence: Synthetic peptide located within the following region: RKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQ
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
Protein Size: 515
Purification: Affinity Purified
Description of Target: SMARCD1 is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. It is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein.The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Two transcript variants encoding different isoforms have been found for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SMARCD1
Key Reference: Assmann,E.M., (2006) J. Biol. Chem. 281 (15), 9869-9881
Molecular Weight: 58kDa
Peptide Sequence: Synthetic peptide located within the following region: RKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQ
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
Protein Size: 515
Purification: Affinity Purified
| Artikelnummer | AVIARP58324_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58324_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 6602 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
